CART (55-102) (human) trifluoroacetate salt
CART (55-102) (human) trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-737 | 0.1mg | 270.00 | + Add to cart |
|
R-M-737 | 0.5mg | 1119.00 | + Add to cart |
|
R-M-737 | 1mg | 1650.00 | + Add to cart |
|
|
Product description
CART (55-102) (human) trifluoroacetate salt,CAS: 214050-22-3 from ruixi.CART peptides, especially CART (55-102) appear to have an important function in the regulation of energy homeostasis. Intracerebroventricular administration of CART (55-102) reduces appetite and stimulates energy expenditure, whereas injection of the peptide into specifichypothalamic nuclei increases food intake.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 214050-22-3 |
Molecular Formula | VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
Molecular Formula | C₂₂₅H₃₆₅N₆₅O₆₅S₇ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product